PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 839aa    MW: 94998.4 Da    PI: 5.6523
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589174.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK506e-16650694448
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                      is ++l+++F +++ dAAk+Lgv  ++LKr CR y I RWP+ k
  XP_009589174.1 650 GISRSVLEEQFGKKLSDAAKSLGVARSTLKRMCRDYDIYRWPRSK 694
                     6999**************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.843635720IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.602.7E-4636686IPR009057Homeodomain-like
PfamPF020424.2E-13651694IPR003035RWP-RK domain
SuperFamilySSF542777.2E-17752837No hitNo description
SMARTSM006662.4E-15755838IPR000270PB1 domain
PROSITE profilePS5174518.234755839IPR000270PB1 domain
PfamPF005647.8E-15756837IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.8E-15757836No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MWPRQRTTKR GDGINRWVFW TQHNGDELNQ VKSLFPVLRG YEFEPWKQPP VEMQGDSTQP  60
DTNGDSQLNR LTIKNLVELL DVQGTCLIQF WAPIRINSGK TFLTTADQPF AFNGKIHEGL  120
WAYRRVSLLT IASVDSTEID ETKRVHVHGR PARVFRSGMP EFSPHVRYYY MDEYPLRNFA  180
MCLGVGSYWT LPVFESSGDR CIGVLEYAFE ANVGLDLYST LDCLINNHRI LKTMGLALIP  240
SWLACSQEIQ EVWEQELAKV KEALEVTCKT HRLLFAQTWI SVLDSSRTQM LITSPPTKYW  300
SEEITSLEFL AVSDLHHVRI GQGLVGKVLS SKGSCFCRDI TQLSIDFYPF VPIARCAGFT  360
ACFAIFVRLN SACHMVLEFF LPNDETLDRN PQSFLSKLLA TIREQLPSFF LDSGPSLFVE  420
VIRTAPVDEL DSFEISQLQQ GVRSKGNEKM VLFDSLNQDS ADLGPSSSTD IGAHHMEIAK  480
DTPDNGEETV LPDSAHKQGV EEADAMDKEK SSVDFILATS FAVSEKKLQQ NLSTDKASLD  540
EKLDSFEIGH RQLPSMVQYD TINQIFGFDP SSSSDLEEII TADYGRDTQL NLQSKKRGES  600
TQPDLAHQQR VEEADVGDKR RHSVHVEENA NSHNCPEKHK RIKRIEKEYG ISRSVLEEQF  660
GKKLSDAAKS LGVARSTLKR MCRDYDIYRW PRSKSANDVC SLSENKPVKR VENQTGNSSR  720
EDLQLPHAGL SNGMDTTTTL TQRKKPTATF QSDNAMSVKV TYKDVTIRFP FSLSSGKIDL  780
ETEVEKRLKL VLIGSYSIKY EDEDNDWIAI TCDSDLEYGM HTLRSLGRTT MKMLVEPLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589174.10.0PREDICTED: protein NLP7-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.12e-41NIN like protein 7